PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000206199
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 488aa    MW: 55446.3 Da    PI: 4.7751
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000206199genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM75.81.1e-2381402128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv.ePwdLpk....kvkaeekewyfFskrdkkya.tgkrknratksgyWkatgkdke 91 
                    p+G++FhP+d+elv +yL +kv+g++++ ++vi+e+d+y     +d+ +    +  ++++++yfF+k + + + tg+r  r++ sg+Wk   +  +
  MDP0000206199   8 PVGYKFHPRDDELVGYYLYNKVRGTPFRDDNVIPEIDLYGXmXARDIWNnnggQNIGKDEDLYFFTKLKPAXKgTGSRVARTIGSGTWKGETSGAK 103
                    89***************************999******976367788532444333467799****987665548**************9999999 PP

            NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    v++  ++e++g  k + + + + p+ e+  W+mhe++l
  MDP0000206199 104 VKDPkTKETIGFFKRFQYKNTKYPQ-ESGCWIMHEFSL 140
                    999867888*********9888888.7999******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-275168IPR003441NAC domain
PROSITE profilePS5100529.7697169IPR003441NAC domain
PfamPF023656.3E-188140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MAPSDTFPVG YKFHPRDDEL VGYYLYNKVR GTPFRDDNVI PEIDLYGXMX ARDIWNNNGG  60
QNIGKDEDLY FFTKLKPAXK GTGSRVARTI GSGTWKGETS GAKVKDPKTK ETIGFFKRFQ  120
YKNTKYPQES GCWIMHEFSL HPKQVMRIKS SPSSRLNDGE YVVCRVRKNF DRKRKADDHE  180
TGVLQSQSKR TRMQSENIDE SYVTPMSSEV NTDHYNQQQQ DQTNINATST SSSISVTNVD  240
QAHYYYCEPA QYSEVIIQYD IPQQQEQATA TSGHLNGTNL STRLAEQQHY FVTQXPTXAS  300
SSLAVAGPDN QEQQVQSNVT DLPQYLTDLR QYYYDTVVPX TTMPMPDDYV CLPQPNFVVD  360
PTMASSLGXS MSSQEDYLQH NGFVNNVMAD LPQYYCSSTQ DPSSGTVFSQ YDLPXTATTG  420
FDDQPHYFVT XDHQPDYFVA DPTXASSLAS PSNLDQKHHI MDKDQLPPXN FDYTHGDIMI  480
DLDDLWNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009372720.10.0PREDICTED: NAC domain-containing protein 2-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55724133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-19NAC domain containing protein 38